PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC05G12040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family FAR1
Protein Properties Length: 145aa    MW: 16720.1 Da    PI: 4.4582
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC05G12040.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1392.6e-1288134147
             FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk 47 
                      +fYn+YA++ GFsvrk+  +++kr g i +r+fvCs+e +++++  +
  OPUNC05G12040.1  88 NFYNSYARRKGFSVRKDIVRREKRVGAIQSRRFVCSNERTQDTSLVN 134
                      6*************************************999887665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.5E-988131IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MGEFRGTINE DDAECGKDCS TNSYMDNSSN TNDDDYAECS LGDYNISQPH DPSSSHNVFH  60
SVEEDNVALD EYWNIVKMNF QTEDECYNFY NSYARRKGFS VRKDIVRREK RVGAIQSRRF  120
VCSNERTQDT SLVNPEDRVK ANISI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0934921e-107AC093492.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0059G01, complete sequence.
GenBankAC0934931e-107AC093493.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0072C16, complete sequence.
GenBankAL9548281e-107AL954828.3 Oryza sativa chromosome 12, . BAC OSJNBa0022M02 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAP0149611e-107AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankAP0149681e-107AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619261.11e-59PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A0E0L1Q01e-105A0A0E0L1Q0_ORYPU; Uncharacterized protein
STRINGLOC_Os05g06170.14e-81(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1712033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18960.16e-10FAR1-related sequence 12